PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_013693-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 557aa    MW: 61014 Da    PI: 4.996
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_013693-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-174087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lvd+vk++G g+W+++ ++ g+ R++k+c++rw ++l
    NNU_013693-RA 40 KGPWTSAEDAILVDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding491.4e-1593136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+  ++++++++G++ W++ a++++ gRt++++k++w++
    NNU_013693-RA  93 KGAFSQEEERMIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 136
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8723587IPR017930Myb domain
SuperFamilySSF466894.49E-3039134IPR009057Homeodomain-like
SMARTSM007174.1E-153989IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-234194IPR009057Homeodomain-like
CDDcd001671.08E-114287No hitNo description
PfamPF139212.9E-1543102No hitNo description
PROSITE profilePS5129425.69988142IPR017930Myb domain
SMARTSM007171.3E-1692140IPR001005SANT/Myb domain
CDDcd001675.30E-1295136No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2595141IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MSRSTNDSEE SMLSKDQIDS PSIDDSSCGR TMGGGVVLKK GPWTSAEDAI LVDYVKKHGE  60
GNWNAVQKHS GLFRCGKSCR LRWANHLRPN LKKGAFSQEE ERMIIELHAK MGNKWARMAA  120
HLPGRTDNEI KNYWNTRIKR RQRAGLPLYP PEVCLQALNE SRQTQNSVEI NSVDKRHHDL  180
LQGNSYEIPD VIFDNFKATQ GALSYPSALP NISTSNILTQ NLVSSQNYSF MPPIMHHTKQ  240
LRESEGLFPG LNGNVTSALP PFDQFQGDNC EKIHRPFGLS FPYDPDPNAK DPPHFGSHAL  300
INGNFSASKP IPGAVKLELP SLQYPETDLG SWGTSLPMPV SLESVDTFIQ SPPPTGSVQS  360
DCLLPRNSGL LEALLHEAQN ISSAKNQSAD KSSSSSVVTP NEVVDSSNLN LCETEWDEYS  420
DPISPLGRSA ASVFSECTPI SGSSFDEPPS NDILPGSNIK PETAEKVSTP DGDKEILNRL  480
DFSRPDALLG SDWFGQSSDN GKDLSVVTDT IATLLGEDFC SDYKQMTAET SKMGQGWGLG  540
SCAWNNMPAV CHMSELP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-32381415107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010266745.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_010266744.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_010266743.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_010266742.10.0PREDICTED: transcription factor GAMYB-like isoform X1
SwissprotA2WW871e-156GAM1_ORYSI; Transcription factor GAMYB
TrEMBLD7UD270.0D7UD27_VITVI; Putative uncharacterized protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-130myb domain protein 33